PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 320aa    MW: 36628.2 Da    PI: 6.2553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589203.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+++++ +G+g+W++ ++  g+ R++k+c++rw +yl
   XP_009589203.1 14 KGPWTSEEDHKLIEYIQVHGPGNWRSLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   XP_009589203.1  67 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEVKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25664IPR009057Homeodomain-like
PROSITE profilePS5129425.429965IPR017930Myb domain
SuperFamilySSF466896.74E-3111108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-161461IPR001005SANT/Myb domain
CDDcd001675.82E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.24566116IPR017930Myb domain
SMARTSM007174.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.8E-1567111IPR001005SANT/Myb domain
CDDcd001676.35E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRSPSSDKN GLKKGPWTSE EDHKLIEYIQ VHGPGNWRSL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIAARLPGRT DNEVKNYWNT HIRKRLLKMG  120
LDPVTHSPRL DLLDLSSLLN STQFNLSSLL GLQAFVNPQV LALIATTLFT PHTENPEMLL  180
QRQLQENQFL NVQIQNQEGS QVLFQKYQEN QILNAPMENP TPTFQPYNQF QDRTSEIPTC  240
TKSNLGSYNL VNGQNLQENV MLPLQNYGQI LQENSSGQNF SFDSVLSTPL SSSTEDERDS  300
YCSNFMKFEI PESLFFDDLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-51HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589203.10.0PREDICTED: protein ODORANT1-like
TrEMBLA0A068UUB71e-136A0A068UUB7_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000472191e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-94MYB-like 102